Aller au contenu
forum sidasante
Cheminot

un peptide endogène accélère la "transmission"

Recommended Posts

Le journal "Cell" vient de publier une nouvelle découverte qui plonge les chercheurs dans l'incompréhension :

http://download.cell.com/pdfs/0092-8674/PI...67407012846.pdf

Ils ont montré qu'un peptide spermatique endogène accroît l'infectivité du "VIH", à savoir qu'on dose plus de P24 dans les celllules cibles du "VIH" en présence de ce peptide nommé SEVI (Semen-derived Enhancer of Virus Infection). Son action est dose-dépendante (comme on peut s'y attendre pour une maladie que nous considérons tous ici comme biochimique).

En fait ce peptide présente une séquence issue d'un enzyme prostatique, la phosphatase alcaline :

GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY

Mon opinion personnelle est que cette séquence provient du découpage du gène de la phosphatase alcaline liée à l'action d'agents oxydants et qu'elle doit être d'autant plus présente que le stress oxydatif est important.

maintenant, quelle peut être l'action de ce peptide? Apparemment, si je comprends bien, s'il manque la fin de ce peptide (LIMY), l'acitivité diminue - Wallypat, peux-tu confirmer cette traduction p 1060, colonne de droite). Il y a certainement quelque chose à voir avec les réactions redox puisque l'acide aminé terminal est la tyrosine (Y), capteur de peroxyitrites... tout cela est encore à creuser.

ce qui est sûr, c'est que le sperme (et sans doute surtout le sperme dégradé par oxydation) comporte en lui-même de quoi accélérer l'infectivité d'un rétrovirus, qu'il soit exogène ou endogène, comme nous le pensons ici.

Partager ce message


Lien à poster
Partager sur d’autres sites

Wallypat, peux-tu confirmer cette traduction p 1060, colonne de droite

Je ne comprends malheureusement pas la plupart des termes scientifiques utilisés dans cet article, donc il m'est difficile de confirmer l'exactitude de ta traduction.

Mais je trouve cet article effectivement très intéressant puisqu'il confirme que l'on trouve dans le sperme quelque chose (peptide) qui favorise l'oxidation. En d'autres termes, c'est encore un article de plus qui appuie, s'il en était encore besoin, les vues des dissidents défendant la thèse des agents oxydants comme cause de l'apparition des marqueurs du "VIH" et puis du "sida".

En soi, cette découverte me semble amplement suffisante car les expériences ultérieures faites sur des "virions" de "VIH" sont sans intérêt pour moi vu qu'il n'a jamais été prouvé que ces "virions" de "VIH" sont bien des rétrovirus exogènes qui auraient contaminé des sidéens, ni même qu'ils sont infectieux et encore moins qu'ils soient en mesure de provoquer l'apoptose des T4.

En tout cas, cet article me semble pouvoir servir de référence supplémentaire au sujet des effets oxydants du sperme. C'est une raison (parmi d'autres) qui peut expliquer, tout simplement et sans référence au "VIH", pourquoi le safe sex a permis une baisse des cas de séropositivité.

Partager ce message


Lien à poster
Partager sur d’autres sites

Le journal "Cell" vient de publier une nouvelle découverte qui plonge les chercheurs dans l'incompréhension :

http://download.cell.com/pdfs/0092-8674/PI...67407012846.pdf

Ils ont montré qu'un peptide spermatique endogène accroît l'infectivité du "VIH", à savoir qu'on dose plus de P24 dans les celllules cibles du "VIH" en présence de ce peptide nommé SEVI (Semen-derived Enhancer of Virus Infection). Son action est dose-dépendante (comme on peut s'y attendre pour une maladie que nous considérons tous ici comme biochimique).

Deux nouvelles publications concernant le SEVI...

La première publication concerne ses propriétés chimiques; Cheminot (toujours lui !) en saisira peut-être la portée ?

La seconde publication est parue en mai.

Des chercheurs ont démontré in vitro qu'un des principaux actifs antioxydants du thé vert (une "catéchine") dégrade le "SEVI" et réduit drastiquement "l'infectiosité du VIH" (le dosage de P24). Ils souhaitent ainsi en faire la base d'un microbicide pour combattre l'infection du VIH. Il serait plus intéressant à mon sens de se focaliser sur la source (l'origine du SEVI) mais on peut espérer qu'ils y travaillent également...

Également un résumé en français, ou en allemand avec les graphiques correspondants.

Partager ce message


Lien à poster
Partager sur d’autres sites

Je ne saurais être très exhaustif après une première lecture de l'abstract, mais je retrouve là un lien fort avec mon hypothèse des oxydes d'azote.

En effet, l'arginine est la source de pratiquement tout le monoxyde d'azote fabriqué par les différentes NO-synthases.

Alors, si on supprime l'arginine...

Maintenant, est-ce que les polymères anioniques interagissent avec le groupement caractéristique de l'arginine, ou bien bloquent-ils le Fer +III de l'hème des NO-synthase? Je ne sais. Mais tout cela est de l'ordre du possible.

En ce qui concerne le second papier, là encore, on ne sait pas trop ce qu'est cette "fibrilogénèse". Est-elle due à l'action de peroxynitrites apparaissant en présence de Sevi?

En tous cas, le caractère d'agent de capture des peroxynitrites, bien connu pour les polyphénols, est vérifié ici avec ce constituant du thé vert.

Partager ce message


Lien à poster
Partager sur d’autres sites

Cheminot :

However, the PAP247-282 fragment lacking the LIMY region did not exert efficient transdominantnegative effects on fibril formation by other PAP fragments (Figure S4).

Je ne sais pas si ça ne contredit pas (partiellement) la phrase qui précède, ou s'il s'agit d'autre chose (d'autres PAP).

En cours de route je voyais cet autre article de Cell, de mars/avril 2008, sur le même sujet, en français, où il est plutôt question du p41.

Point d'intérogation : ça focalise surtout sur la transmission hétéro homme > femme, dont on sait qu'elle est au bout du compte très faible (si elle existe).

Intéressants aussi ces articles sur thé vert...

Partager ce message


Lien à poster
Partager sur d’autres sites

Join the conversation

You can post now and register later. If you have an account, sign in now to post with your account.

Invité
Répondre à ce sujet…

×   Vous avez collé du contenu avec mise en forme.   Supprimer la mise en forme

  Only 75 emoji are allowed.

×   Votre lien a été automatiquement intégré.   Afficher plutôt comme un lien

×   Your previous content has been restored.   Clear editor

×   You cannot paste images directly. Upload or insert images from URL.

Chargement

×
×
  • Créer...